GenomeNet

>tr:A0A6I1FNM4_9BACI [A0A6I1FNM4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KAB7672229.1};
MSIPTQNVRRKSFPSQILAYYEYMLQVVSREKHPNTIKNCMQLHLLKPFPSSTIRKLQDD
YHSEFREEWCLNGDLNTYWANIYACFSYLVKQQVDDLKNSQLKWLEKSFFQLFEQYEFLE
ERIEKYPDFYQEYMEYEKARILILYYIHLNKAI

BLAST