GenomeNet

>tr:A0A6L2ZKC4_9ENTR [A0A6L2ZKC4] SubName: Full=Type III secretion system protein {ECO:0000313|EMBL:GFN45287.1};
MLLTLSPELKELSALIGNGRTQGAVTTTFKMMEGKGVCLPVSLEGVNCGIWLSEQEWASW
LESVLAVSDPNCLNNDLLVGMSHWLLSSLQRVLPLLVVSNQLSRPYDLLKQWAVVCTFSL
ENQQFNAVLFDWPLMKLHKIFADWPSDQPSSLGSKSQSLGYQCGLVAGWCRLSLTQLRTI
KVGDGLRVCAAADLENNCCWLWQLCGSQFYIRLSEENQMTIQNINQDIDELLHLDTDTTA
GSAVENLHSVSLDALKKTLVMEIGRLDMKIEDIKALSVGQTLACKSSCYGEVGIRLDGQQ
VGSGNLVRCGEELVVRIDQWALE

BLAST