GenomeNet

>tr:A0A6L9HEZ5_9CLOT [A0A6L9HEZ5] SubName: Full=DUF5026 domain-containing protein {ECO:0000313|EMBL:NBI72961.1};
MPLVTEKPAAAFDLAQIRRGDLLWGRHSTWDRGKAGFVTSATEGQLIVQYYPGIGNVTNH
FIIPVSEAAEGQWEIRWSSDMAEIRDYNIKPDGGQQETEGGGGGDAGGADL

BLAST