GenomeNet

>tr:A2SQY0_METLZ [A2SQY0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ABN06736.1};
MIVEGICVVIAAYCASRAVFEPKTLKKLPYLNVMNFAVAGAIVLLMPYPITIGAAIAYFI
GSTLESNAIASTFARLEEQ

BLAST