GenomeNet

>tr:A6UTX4_META3 [A6UTX4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ABR55946.1};
MDIASITIEIIAIIIAVKVFITRSRALKLLYICNLNFCIAGLIALYIKSPMGALVAMAYF
VFSTISSNAIAHSIGEIKKIK

BLAST