GenomeNet

>tr:B7GLY7_ANOFW [B7GLY7] SubName: Full=Uncharacterized conserved protein {ECO:0000313|EMBL:ACJ34866.1};
MKVNHDVILELEKMSILLNNDFPSEDIERIENTILKDNDKYCLTGDFDSFCSLISGSLSY
VLAHKKIPRYQRKLLYKDFFALYPYYEPLRKHLEKFPHFSEELKVHERVRELLLEVVKSY

BLAST