GenomeNet

>tr:C1JAW4_9REOV [C1JAW4] RecName: Full=Protein P7 {ECO:0000256|ARBA:ARBA00016841};
MSAIVGVCLLSETTVLVRNLNDVVKGLYSRIRGNVTPPKESIEARVSGQTVKVQRTIPIN
TVFIEYLDQDYISANPTMSAMEIIGSSGNTAPKTTFQSLLPSLSALFGVAFIQGAFMHRV
ISTTGPTISFLVLVIGPPGNFTRKPSVAAASSVVQVESTSDIDLNDTVKINALMLQNTKL
VSASAIHATSLGEVSEKCDSLDTMIIMKALTYFKRYAYEQSLGTMDNATRVYLNLPIDEI
FSGRTASGEQLQNKIATFKESRGHLAGVVLPDGHGKSTLVSDYPEIFTLLKDNNEATDPS
DNGEIEANKSKGKYEGKIVLASSVKELFDNGIRVLGVLKLESEAQVEDEINKDQVLKNKK
DKIMEGWKNTSGPNVVTSKNLPLLHDKVMDIVTTHTKGIKTNRSGKPIEIKTDPKLRPET
RISIYFKNGFPIARYSTNKLSKHGIDVVEAKDLNEDTIIVSNKPKNTPRRVPQNVKTKLE
SMRSNLKVDVDTDNLTEEEFIAKIKAL

BLAST