GenomeNet

>tr:D2TKF2_CITRI [D2TKF2] SubName: Full=T3SS structural protein SepQ {ECO:0000313|EMBL:CBG89722.1};
MKPLNSQSNMKINDFYLPLLPVIGIGRLYITSEGHACHAYFREVSGNGFRFTLAYSGYEG
CFWVSEEQLIQWCHELFPYSDSRLIPEDTIKLMLLWAIHATLPEDDASVDDVQFTTLNKD
IYPVIENNNGKNRLNVIILETTVQSLQYLINDNWQLVPHSNTLFFDGYIAPGWTDYPITK
LSIGDSLRLYHVDDSQERKCWLVINNPLATVKLSDNNLSVTDVQAADPLCIISNETVMNR
IYCAIGTINVDIHKLRNLKKDDTIGSVGYHLFGGGRLIRNNTIIAYGTIIKINEDFYFNI
SVVCD

BLAST