GenomeNet

>tr:D3E3Z9_METRM [D3E3Z9] SubName: Full=Energy-converting hydrogenase A subunit C EhaC {ECO:0000313|EMBL:ADC47260.1};
MYIEIIGVITILMALRAVITKNRAEKLLYINVIGFCVSAIIALYIKTTFGFVLAAAFFIS
STIGSNAIAYSLKDLEDEISYDKDMEERDEEN

BLAST