GenomeNet

>tr:D7DQW7_METV3 [D7DQW7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ADI37244.1};
MESLVILTIGFIGIICVARIFLTKSRALKLPILCCLNFAVAALIALYINSPMGALVSIIY
FVFATLSSNAIAHTIGELDKFQDIDKFEKDDDEFFK

BLAST