GenomeNet

>tr:F0T710_METLA [F0T710] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ADZ09530.1};
MLIEILGIIVLLMALRTLIAEDRAARLLYLNVIGFALSGMIALYIQTPFGAIIAITFFIC
STLSANAIAYSIGRNKREIVLDD

BLAST