GenomeNet

>tr:F0Z7Z9_DICPU [F0Z7Z9] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EGC39934.1};
MALKGAGSLNEQSVALITSEKEKINQIRSFEDSHHYINFSRSQNPCLSLVDTRLSTLVLE
YNPSTIQHIAGFFDLCSLMVSKTDISGFNLQIASIMSSFLPTNIKNLSFERETALKEKLA
MTFSNSTVLNETFRIQNVKSVKRYLTISVTNKTFNACRIFAFSDVKKGFSISNLNYLFY

BLAST