GenomeNet

>tr:F6BBD7_METIK [F6BBD7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AEF97144.1};
MDLSSIIIGVIAVICGLRVFLTQSRARKLLYLCCLNFCIAALIALYIKSPMGSLAAIVYL
ISSTLSSNAIAYTLEQMKKME

BLAST