GenomeNet

>tr:G0W885_NAUDC [G0W885] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CCD23996.1};
MPGEIETTYFDSLSEQEQHLQENYSCIKDIFKTLKQLKNKDATDDELKQNLDNLSIYYRD
LTRSSIDLKYNKYQTREIQLSHLDKISNEAQTFKRKHKTIYLREYVNTTESINGKSLEYI
NLLQRLSVDLVRQIEISDPNVSKINVDGWNPPKKIQVLLDKFGEPDADTRELKIQVQRYL
DDIKMSRAKYSLENKYSLQEKLSEVTKAVNQWRAEWDNIEMMLFGDGSNSMKNMLANVES
IKSKLEEEAKAESKEEEGEGEGNDVEMT

BLAST