GenomeNet

>tr:G9RUF2_9FIRM [G9RUF2] RecName: Full=LPD23 domain-containing protein {ECO:0000259|Pfam:PF18838};
MADPEKLVRAVERDRGLMETFLDFVRGLKNRIAIRLSGSERAMLDEAERTLVNLLRGEAG
SVAGEKYSFVRATDAEQIARAQELEAQGENAKTIWSETHLTRDGGGAWVQEINDHDAKPR
PDGDARGETGGRLADYLEHPELYEAVPGIADINVELGTLSESEKGKYSLQERTLRFTEDT
FKNKSMSDIMHEVQHAIQNEEELATGGSRKLAYAALVSDAYEAVKDTPEFQSLQTKEERL
HYLEEAAAKQAGAPDIETAATNGYVNLGGEKMARQTAKRWYYTKDQREKTWPDVAGNVLD
KSVESQRIVETLERIGYTEDEIEAFIKNWGGQK

BLAST