GenomeNet

>tr:H1Z142_9EURY [H1Z142] SubName: Full=Membrane-bound hydrogenase subunit ehaC {ECO:0000313|EMBL:EHQ34518.1};
MIELWICGLVAVYAAIRIAFVKNNLLKLPFLNVIGFAVAGSLVLILKDPLSLAAAAAFFI
GTTLESNAIASRIAGGKKE

BLAST