GenomeNet

>tr:H2A239_MUHV1 [H2A239] SubName: Full=M08 protein {ECO:0000313|EMBL:CCE57008.1};
MGLYLDLSQFLLLAVIVTESVVLSMICDTNAHSDLPQGKCTILSKTPVRNDSNLGVDGWG
YECPLGDICIPASWQVKWYIGLYQMDTGGFFRSSLTKPPTFQGLSMYVKDKTNARPDGFA
IKDEDGRLIVTVDANRPFTLGCKVTVCKREPDYGPATEEPTTAERSTTEPVPIPTTQRIT
TRSEPQTTARPTTRPTTTVSPTTRPTTTVSSTTRPTTTVRPTKKPIPHPTQKPVPPARPK
PITRKHTSITQALVKFSTSSPTTLFPGSDNADDTVAATAEMQTSHTVTIAVSVAVTIFVV
TLIALAVLYHYGFLGRSAILDLYAERLRARFSSRDPETFRPTDESEPLRTTSSPAS

BLAST