GenomeNet

>tr:H2A240_MUHV1 [H2A240] SubName: Full=M09 protein {ECO:0000313|EMBL:CCE57009.1};
MKLFFSSHLYFLIFAVIAAKSLITSAAPCDTARDMAFSSTVTPGHCRSIVVTLKDLYGLG
SSSTWVYKCEFPIFCINATWRVEWLLNKSPINVSVLYESTTSTPPRFKQLITNNATTRPP
PTGFEINRDNGYLYIYPDAGNNFYLSCTGFVCVPPKPITTTPSTTRSRSSTETRTTRSGT
KFIPHKITPSGSQPVSPQVDDTTQLDIDTAIIVASAEMQTSNTPTAIAVSLVVIVVVTVI
VLGLLYHYGFLGKWALLDSYVDRFRVRFMGNTPDRPTVETEPLRSTASRAS

BLAST