GenomeNet

>tr:H2A241_MUHV1 [H2A241] SubName: Full=M10 protein {ECO:0000313|EMBL:CCE57010.1};
MKVSPDRLLQLSLVLAVFASPRVASRKCDPVISKSYSSRTPPGTCTGASVYLEIISKSHS
TQTWKYECQLPEACIEATWQVKWTVNRIPMNATALYNSTDSSLPKFDKILVINATTKPPP
KGFTVNPHDGYLYLVSSPDETVSVHLQCEGFVCLPNKTIHVTTNPPTTISRTKRDTTKFI
SLSSRSQPVTRQATDTTVSNTASSTDNAVIVANAEMQTSNTTVAIVVPLMVILVATVVVL
GFLYHYGFLRKWALLDSYLARVRGHFTTSDPESSRPESDPLNSPPTSVL

BLAST