GenomeNet

>tr:H8ZA02_NEMS1 [H8ZA02] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EHY66783.1};
MKKLQQKTKTKEDCLEEIEAQNYKTSLEARKTLNSILRTTDKTTNMIYEQREVLEEIRDE
SYFARDNLEKSANLTVKMKRAGKLLVVGDKVSDKIKSLFKSAPKPKQDYPNSITPADTAQ
ERIEEFFPEDKSAVKETTTDVLMSIRNGLKTLHTKLANQNKELKNQVPLIEDITETNAKS
STKAEKVMKSLRKI

BLAST