GenomeNet

>tr:I3EJJ6_NEMP3 [I3EJJ6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EIJ89393.1};
MKKLQQKTKTKDNYLEELESVNYKTSLEAKKTLNSILRTTDKTTAMLYEQREVLEDIRND
SYTAKDNLEKSKGLTVKMKRAGKLIVIGDKVSDKLKSIFKSAPKPKQNFPSFTSPTDHAA
PDSEEFPTEEKEITKETTNDVLISIRNGLKTLHSKLDKQNKELNSQNPLIQDITETNKKS
STEAEKVMKSLKKI

BLAST