GenomeNet

>tr:K7YI41_9VIRU [K7YI41] SubName: Full=Putative ankyrin repeat protein {ECO:0000313|EMBL:AFX93019.1};
MNSYQRINVGNLNSEYFTIVNEDNIGSFNRYQYRTGINVWCDHYQTLTRLPFNMAPEVAP
VFFDVKNIFDKLFAATFEKESIKTIRFDRNKYITSNESNMKKGHYPCKNFIRQVFPMTTD
NGFEILYNTKMRHYVATKIIVDHLYDLSDIRTIKWLVQQGADPNNRHLLRWAIQKGYMDI
VKYLIEEIKIDYQSIYQYHTELSMASYEGHTNIVEYLVQLGMDVNAYDNIALQTAANRGH
SKIFEYLLLQSNINDKLYQCVDTMIADVCSKGHLKIVGGKVISTLKNTISQINSGIEIKL
VDICSQNQLDIINDTVTSILENKLVKFDIENEHLVGNDFAAIAKLLIIVKNITIGK

BLAST