GenomeNet

>sp:YE72_SCHPO [O14155] RecName: Full=UPF0047 protein C4A8.02c;
MDVIQRIITLDRRSKGFYIITNDLVKKLPELKSFSSGTVNFFIQHTSAALTINENWDADT
RADMNDILDKIVPESAGYRHTAEGLDDMPAHVKSSLIGPSLTVPITNGKLSLGTWQDIQL
AEFRRQPHSRTIVCTIIGLRSN

BLAST