GenomeNet

>sp:Y386_METTH [O26486] RecName: Full=Uncharacterized protein MTH_386;
MLIMLIQITGIIVVLMALRTLLAQDRAERLLYLNAMSFGISAMIALYVGTAFGAVLATVY
FVASTITSNAIAHTLDRVGEEMVIED

BLAST