GenomeNet

>tr:O27317_METTH [O27317] SubName: Full=Conserved protein {ECO:0000313|EMBL:AAB85738.1};
MYLIIMKSAVLFISSILVILAALGILRFRDNVERVLYARIHILGIADVACILALLALGEP
LLAATYFILAPFVSHAIANAHHYGEGD

BLAST