GenomeNet

>sp:L5_VARV [P0DOU2] RecName: Full=Protein L5;
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMHKRK
IPDPIDRLRRANLACEDDKLMIYGLPWITTQTSALSINSKPIVYKDCAKLLRSINGSQPV
SLNDVLRR

BLAST