GenomeNet

>sp:YWQE_BACSU [P96717] RecName: Full=Tyrosine-protein phosphatase YwqE; EC=3.1.3.48;
MIDIHCHILPAMDDGAGDSADSIEMARAAVRQGIRTIIATPHHNNGVYKNEPAAVREAAD
QLNKRLIKEDIPLHVLPGQEIRIYGEVEQDLAKRQLLSLNDTKYILIEFPFDHVPRYAEQ
LFYDLQLKGYIPVIAHPERNREIRENPSLLYHLVEKGAASQITSGSLAGIFGKQLKAFSL
RLVEANLIHFVASDAHNVKTRNFHTQEALYVLEKEFGSELPYMLTENAELLLRNQTIFRQ
PPQPVKRRKLFGFF

BLAST