GenomeNet

>tr:Q1ITD8_KORVE [Q1ITD8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ABF39862.1};
MSRTALSHSNSQQENTSSNSLRVGDPNSSFEREADRFADQVMTGESHKSPWSLSRVSLGQ
TLQRKCGCKGSSDSKDECDDCKKKKLLQRKPAALGAPHVAPPIVHSVLNSSGRSLDHATR
SFFEPRLGVDLGSVQVHDDGRAARSAEAVNAHAYTVGNSIVFGEGRYQPESAEGRRLLAH
ELTHVVHQQGPSERLVQREEDSDVEVADAPRTGSLIEKAFDAADAAHWEQAAELANGLSA
GDLKAFIGSLGAGWKTEQLHIGAISNARVGPGSAVAKMTHWAFLNAKFSEQMKGGFYQAA
SEYLNGFSQGEIRSRISKMKTEVVAGLHSGAVAQPGIGADSNAAKITGEELDKRKEKGDA
AADAATKAAIPENPQQKKKRCQDTAGQGFKIFPLRLPKGMWQLSNAPIGAERKGDEILVK
QPLNDVKGDPMFRRETKTLPLETFLGGIRLKKDEVVGVRLYDDKERLVCVTGEDMLKFND
ATEMALWFSVGRTALDAATIFAPGASAGASKVTGFAVGNIVAGELLDVGRQEMEVKYGLR
EEVDWGGIAFDTVFQLATLGFSKYLNNAATKAVLGKAPELGQKPAQLAVHAALAGATNLV
QTAARTAFDMLRKEKKKFVMEDFLIELAQAFATGTLFAFVHGAAVHEEGLPQEKQAAPSE
HQQGAPPVHDQAAPPLHDQAATPVHDQTAAPVAKPQKKTPPVHTDEHVTTAPPDKAPGER
KGAAPLHEDTPPATTQKRAIGAPPEEHAGTPSAKKTDGPEGQTAAAVQEKDATAKKKTAD
GKHDVVVTEQGVGKCSPPPCPVIHVEYKKELDAHPEFKEWNESVQNMRKADPEFAAEQGK
KLIAALEDVRANGGKLSGEKLVQHREAALQARLAEAEGDLHKARWDTIDYQAERAATGKS
RKGGPIKGLWNVKERIWAIKRQMAYPNRTILEQAHIVGVRAPDGTIKPTNEIGKGGRIPD
YVEVRGQKIVAGDLKSGEEFKKSIAGGLAKPGEIEAEFRKSAKIAQQQGVEDKVLNAAKG
NGGKIVIEGFDVTTGEKVVKEVDPADYGSEVITYDDVRTN

BLAST