GenomeNet

>tr:Q1QPZ6_NITHX [Q1QPZ6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ABE61701.1};
MSAHRALAVKAAPAVQTAAPVTLQRTCACEETGEKCPRCAGKRTRLQRFGTGAPPLALPG
AVGDVLRSPGQPMPRALRTRMEEKFGQDFSAVRMHADASAQNSAAAVNARAYTVGRDVVF
ASSAPDLVSTAGQRLLGHELAHVVQQSRGGVAAGIDPDPALEAEAKRAGDAIAAGHPASA
GRAAPVGLQRDAEQPDYPAMEKVTGYVAQALGFNETTSRVVAASLEGGMSGFSHQWNEGK
TGERLGKKFKSFSITDVPDLIKGYLVGVFEGVVSPITDLFAIGVMVEQLNAFVTNLVSSA
ISKAAELANELKGLVDVLAGLGKPIKEFFLGLKSNARETFKMLVGMLNSNGGLVEKAIGF
ARSIGRTQGAAVAKSLESPWEEKTKQPEEKPAGALGYVSNLFGQGRDALIETPWAKVGNK
AGYALGFALIQVVLLVFSEGIGNLITQIGRSLGGLAKAGTFLGRTIEGVTKFVTMAGGII
TKVEEAVNAVVQFLLKPMMPVLEPLLKPLAGMMERMGGFLRKLFGIAEKDAAQVATTAAT
KALGGAHPAPPAPHLPTPATRHPHGPPAKAPVPHGEPHPTPKPVAEPRPAAKATEPHPKP
AAKAPEPAAATPAAKTAEPHPQAMAPEPHKPEPKAPHSASDAAHKPIAEPEPVGGGHHVQ
TTPDGFELCSGPPCPNLRLMYKEQLAADDALRAEMETLEAKRKLAAKLEADGIPDRNFAK
GLNKEAAKLQQKLETAKLHGPTAPKPPPAKPPVAPAPIRGSAKPAPGEALVGSSTSQMRR
RSAKLIASDPDHPLGFLLNKRGRFRSQRGLKHHELMERPDIVQMGHIRSNKLGEDEFVML
QGGWENQFNNVTIEMSHIRGAVLDQPAVSIGGVVVDLKTAQYWENVGLLKRGTVACSPRV
QLPISDIAK

BLAST