GenomeNet

>tr:Q2FMA8_METHJ [Q2FMA8] SubName: Full=Membrane-bound hydrogenase subunit ehaC {ECO:0000313|EMBL:ABD41802.1};
MSIDGTEDLLGLISGPFSSSYISPPSESAELAALMCGLIALYAVIRIILEQDVMRKLPFL
NVFSFAVSGIMALLIPHPLGIIAAATYFIGSTFESNAIASTWAGGVEE

BLAST