GenomeNet

>sp:Y070_ATV [Q3V4T1] RecName: Full=Uncharacterized protein ORF70;
MQSVNEVAQQLFSKLREKKEITAEDIIAIYNVTPSVAYAIFTVLKVMCQQHQGECQAIKR
GRKTVIVSKQ

BLAST