GenomeNet

>tr:Q6LXA2_METMP [Q6LXA2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CAF31006.1};
MESLVTVTIGLIGIISVIKVFLTKSRALKLPIICCINFCIAALIALYIKSPMGAVAAVVY
FALSTVSSNAIAHTLGEIDKMDEFEKKR

BLAST