GenomeNet

>tr:Q6MEU1_PARUW [Q6MEU1] RecName: Full=PAS domain-containing protein {ECO:0000256|Google:UnProtein};
MNQEIVFFSMKFKTTNRQFFSAAVIFFYLLPLLFFVTYSIGLMPHQKSWSILTLGLLLVA
IGSICLILLAYYWEIGLKTKWQGESAILSSQSSFTSEKENKVTALDPAFTLVPLEEAPSF
TTKEEVTLLNSLENLNDEQRKREEELALKQSEIQKLVEENQSLISQTQQTQQDFADYKLF
SEEQLKQKQLQINFLQQTIEDQRSEMEKRQDQIFHLDTKVHDLSYEIKTLLYLHETESNT
SKKEELFKNNSNGPFIEDFDDFPTHTSIIPSLDLKNGYWVKTTIEASALLKKCINMAQKM
TGANYYNNETTRYREFSTSNYAIDQRRLFDNLKNEEGGLIVVFSQKDQKLLFANQQSKAL
LGWSADKLISDFAQIIQEGLNEWRRGLAALTTAAESQIRLLAKNKNGQEVLLSCQLGIIP
SGLFRSYVIAIFYPT

BLAST