GenomeNet

>tr:Q73QN1_TREDE [Q73QN1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AAS10907.1};
MQKNVKPLFPKNLKASGWAFGRPIQNNFLNYETLNMENSLMQKDKLKLIFILMLAVLLFS
CTKEIKEPAEERNSVVKNEVMEKKPLLILEHTIPSKEEDDEDIDFTEEEPPIVLTDENTP
KTELIKLLESKKRHAWSLHKIQLEIDMYDVHGNSYEEFEKSGIDYLNRQKNTEIVKVDSD
NKNIYCKQTLNLPSGKELIYDAVYTFYPYPKNFAYTNYELRDKPIIAYRHVPEAKRVHGK
ITEAAKNPNKNKNIKIFERYINKYTKEHRHKTGDKPYKVFDYVKGNFTGSGKDEYIVLFT
APFTKSELEDGIFLLEYSYIKYVECFIMENDKVIKMYKLPGHWGHVVPRDKTKIDLGEQF
SFGWIADFNQNGINEIFVHRKEVFGSSFFSIEFIDNRFVEIPITNRGDILKSVDWEQSKI
VVETNPFRSLVLDSKDTRPKYFAEYQWCEKEHCYVLLSNKQYK

BLAST