GenomeNet

>tr:Q7DB73_ECO57 [Q7DB73] SubName: Full=T3SS structure protein SepQ {ECO:0000313|EMBL:BAB37988.1}; SubName: Full=Type III secretion system protein SepQ {ECO:0000313|EMBL:ACG59627.1};
MKPLSSQLNMKINDFYLPLLPVIGTGRLYITSKGHACHAYFREVSGHGIRFTLTYSGYEG
RFWISEEQFIQWCQELFPYSESRLIPEDTIKLMILWVMQTALPEGDVSVDDVQFTMLNKD
IYPVIENNNGENRLNVIILETTVQSLQYLINDNWQLVPHSNALFFDGYIVPGWTDYPVTE
LRVGDSLRLYHVDDSQERRCWIVINTPLATVNLSDNNLSVTDVLAADLLSALSNETVMNR
IYCAIGTVHIDIHMLRNVKKDDIINSDGYHLFGGCQLIRNNTTIAYGSIVKINEDFYFTV
SIVCD

BLAST