GenomeNet

>tr:Q8TY31_METKA [Q8TY31] SubName: Full=Uncharacterized membrane protein, conserved in archaea {ECO:0000313|EMBL:AAM01690.1};
MISAQAVMAAIVILMSLRLLVARDLYAQMLYLNVVGFGLAGLVATTWRTDMGLIAALCVF
IFSTLESNAVSYTIQKIEEIRRAGELD

BLAST