GenomeNet

>tr:Q8V3N3_SWPV1 [Q8V3N3] SubName: Full=Uncharacterized protein SPV061 {ECO:0000313|EMBL:AAL69800.1};
MESRNINFTPVFIEPTLKHSLLNIYKYNYIIIFEIIIVILLVYIFFKSEIIMLISYKDDI
SINPIDNFSKSWLSCDGNKLVINNLPNTNGTKTALAINRQDITYKDCNFLLQSINGSSKI
SLNDVLRRQ

BLAST