GenomeNet

>tr:Q9DHP9_YLDV [Q9DHP9] SubName: Full=64R protein {ECO:0000313|EMBL:CAC21302.1};
MASKQNLYFTPVFIEPTLKHSLLNSYKYTFIIFFEIIVVVTLMFIFFKTEIILAFNKTKV
VNNPIDKFKDTFLFCKENKMMIGGLPNNNVTEALTTDKIPIVVDNCEDILKSINGSHKVS
LNDILRRR

BLAST