GenomeNet

>tr:Q9I4Y5_PSEAE [Q9I4Y5] SubName: Full=Colicin immunity protein {ECO:0000313|EMBL:AAG04373.1};
MSFKYYWAKFFWGAFFFVLVAWKGSVFPSLASVNPLVVAGLSTILFPFSVKLVEDFALKY
TEREFWVTGFFSETPAKTGLYAVFYLSCYLFSIPLGMVFLFYKYGKAS

BLAST