GenomeNet

>tr:Q9S0D7_BORBU [Q9S0D7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AAF07515.1};
MKRAKRSFNDYVAYFREGSLSDKEIAAKLRVSKVNVWRMRQKWESGETSVSEDSRLTISE
DTFEHLLSQTFRSEVNARKVRSELDLERANLELGFIHAFKRYSSVELFSMHTKIENLRAE
IDALNKASSKKNKQVVNGEINSLKSELDEYVKECSIREMELYYECMKKLSSAHEVENKGN
YKSYKGYK

BLAST