GenomeNet

>tr:Q9YVW3_MSEPV [Q9YVW3] SubName: Full=ORF MSV129 putative membrane protein (Vaccinia L5R), similar to SW:P07615 {ECO:0000313|EMBL:AAC97794.1};
MVLVKEKPNEKIINLNPTFILWDYEKYFSYGNFTIYIITLIEICFIIFLLFYFFQQELIF
IYNYFVGPQKTDDDIEQFNALDNTLQEIVNSSLYCNGDNLYYKYKGESRQALALNNEPIT
DCNNILNKYVTFN

BLAST