GenomeNet

>tr:R6JSR4_9CLOT [R6JSR4] RecName: Full=DUF5026 domain-containing protein {ECO:0000256|Google:UnProtein};
MALIVDSITKVFDTAQIKKGYLMYAKHRSWPDGRGGFVTAVTDKQITVQYHPGIANVTNH
FFLPADEVAAGEWEVRWSADMIEVHEYRSGGGVGDDVGGVSS

BLAST