GenomeNet

>tr:R9SL67_9EURY [R9SL67] SubName: Full=Energy-converting hydrogenase A subunit C EhaC {ECO:0000313|EMBL:AGN16839.1};
MYMEILGIITILMALRALITQNRAEKLLYINVIGFSVPAMIALYINTPFALIVAAVFFVC
STISSNAIAYTLNKLDDEIVLDGE

BLAST