GenomeNet

>tr:S9XDW7_SCHCR [S9XDW7] SubName: Full=Meiotic recombination protein Rec10 {ECO:0000313|EMBL:EPY51971.1};
MDHINEFLNAIIKGKQLTKALLDRTLNAVLSVDASEVRDKQTISNISNAFSVIGEREQYT
EPKIISCLKVLLHLCFLGKHPDLGDLFIETFTGLNPSLKDSVKKSIGSLALSLGCQFLNE
TDFLNVTTTFELYDESEYQMIVFERVVLQVMSLFIAKCEDNKLYLINNRKELNLQAIGER
LTHRDFACRFLCGLFISRFSVSGSDEESNRQNAIRLSLFCPSDSSKLTLTMQMLKADQIF
QTCVANSTKVYNGTFSVCSETPVHATMIIEPRDVIIYRKGFTLLQLSWGSMKDITMTSDG
PYRFCFTTDIPHLKDCIFECLDDSSFADLSSTLQFVGDSLTPKLFVSPKVAINQSSNSAK
NSMEEVSQHSARDAMEFDSAYEKFENEILDKSLCVEPTNETTTGNNDKSTIKIDEPENAL
NHEDAANEETKEISETAEVTTEGTKQVDPENDTLVTPLRKRTRAGKASTKSSRPPRVKKP
RKTEKVKEADSNLEGLKEQETPCPKNNKQIKEPLRSEEDNSEHSLLDDGEKQNSKDDEQL
STGMQDSVKPEKNTAEPVNNPKSSMQTMGKVKQEPSNQNMNILDHSHQSVLNDHKSIWKQ
MLKDKSWKKELLTPPPQNRKRQIDLATFTKQGHSTLGNTPSLLNACSSPPIEASSLGPFV
KHTDDGLTSSTLISDTNDYMNDVNLQSVKQEEKTLKPPFEFDKVQSKSFGQVDLPNAHGI
ERCVSLIGKNIYSILIKREEKLKDQLNVFHLNSTNLVEGFQERQKARYTSIQKMLTSVDT
SLLHRVKKLIYE

BLAST