GenomeNet

>tr:U6EDP9_9EURY [U6EDP9] SubName: Full=Putative membrane protein {ECO:0000313|EMBL:CDG65213.1};
MLIKILGIIVVLMALRTLIAQNRAERLLYLNVIGFSISAMIGLYINTPFGAIIAITFFVT
ATLSSNAIAYSLGRVKEEIMVK

BLAST