GenomeNet

>tr:W6PW15_METBM [W6PW15] SubName: Full=Membrane-bound hydrogenase subunit ehaC {ECO:0000313|EMBL:CDM26139.1};
MIALYLVAGVAVFAVARALIERNTGRKLPYVNVMNFAVAGALVLLLDHPLSLVAAAAYFV
GSTLEANAIASTYAGGGVKR

BLAST