GenomeNet

>tr:W6TVR2_9SPIR [W6TVR2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ETZ17101.1}; Flags: Fragment;
MNKVKRAYEDYAMYFEEDRLSDAEIAKELCVSRANVCKMRQKWEISQDNPKEFSSDNKIT
ICKTTLNSVLDRVLENNAKARELKSKFSITKSQLGLKFMKAFNNYLELELEDCIEEIDLL
EREIKMIKNKGNSRELQDKKIKLKDLKREKENKTMKLCYETMKKLKIADLDEG

BLAST