GenomeNet

>tr:W7ZG60_9BACI [W7ZG60] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:GAF15536.1};
MTKKWVLGKSFGLLFMLLLLSACSLVDDEPRNIKDVTFLIVDQHNKPVANRWIGIDNDST
DEGREIGTYLGETDENGIIERYSNEVREYQIAYYQGSFVLTEEDEGARITVVITIEEDQE

BLAST