KEGG   Amycolatopsis albispora: A4R43_03230
Entry
A4R43_03230       CDS       T05547                                 

Name
(GenBank) cephalosporin hydroxylase
  KO
K18062  cephamycin C biosynthesis protein
Organism
aab  Amycolatopsis albispora
Pathway
aab00311  Penicillin and cephalosporin biosynthesis
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
Module
aab_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    A4R43_03230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aab01008]
    A4R43_03230
Polyketide biosynthesis proteins [BR:aab01008]
 Nonribosomal peptide tailoring proteins
  Others
   A4R43_03230
SSDB
Motif
Pfam: CmcI
Other DBs
NCBI-ProteinID: AXB41652
UniProt: A0A344L0S8
Position
658937..659626
AA seq 229 aa
MTDTFLDLNQFRGLGEDPVYHPPVLADRPRDWPLDRWAEAPRDLGYPDFARYQWRGLRLL
KDPDTQAAYHDLLCELRPRTIIELGVYSGGSLVWFRDLADLMGLDCQVLGIDRDLSRCQI
PDAEMKNISLREADCADLSTFEQLRDLPHPLVLIDDAHANTFNILRWSVDHLLVEGDYFI
IEDMIPYWHRYCPKLLTEYLAAFRGELTMDMVYANTSAQLDRGVFRRSA
NT seq 690 nt   +upstreamnt  +downstreamnt
atgacggacaccttcctggacctgaaccagttccgggggctgggggaggacccggtctac
cacccgccggtgctggccgaccggccacgcgactggccgctcgaccgctgggccgaggca
ccccgcgacctcggttacccggacttcgcccggtaccagtggcgcgggctgcgcctgctg
aaggacccggacacgcaggccgcctaccacgacctgctgtgcgagctgcgcccgcgcacc
atcatcgagctgggcgtgtacagcggtggctcgctggtgtggttccgcgacctggccgac
ctgatgggcctggactgccaggtgctcggcatcgaccgggacctgagccggtgccagatc
cccgatgcggagatgaagaacatctcgctgcgcgaggccgactgcgccgatctgtcgacc
ttcgagcagctccgcgacctgccgcacccgctggtgctgatcgacgacgcgcacgcgaac
accttcaacatcctgcgctggtcggtggaccacctcctggtcgaaggcgactacttcatc
atcgaggacatgatcccgtactggcaccggtactgcccgaagctgctgaccgagtacctg
gccgcgttccgcggtgagctgaccatggacatggtctacgccaacaccagcgcgcaactc
gaccgcggtgtgttccgcaggtcggcgtag

DBGET integrated database retrieval system