KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1703
Entry
D11S_1703         CDS       T00993                                 

Definition
(GenBank) nucleoside-diphosphate sugar epimerase
  KO
K19180  dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD+) [EC:1.1.1.339]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00523  Polyketide sugar unit biosynthesis
aat00541  O-Antigen nucleotide sugar biosynthesis
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aat00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    D11S_1703
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    D11S_1703
Enzymes [BR:aat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.339  dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD+)
     D11S_1703
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_10 NmrA 3Beta_HSD adh_short NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind KR DapB_N
Other DBs
NCBI-ProteinID: ACX83066
Position
complement(1632611..1633423)
AA seq 270 aa
MNIIITGANGYIGRYVVKELLNKGHKVIAILFDGESPHSFLSGAELFYGDIFALSQEKKV
DLVQNAECLLHLAWQAGFNHRDPSHLNNVMKHYQFLTSMAELGIKNISVAGTMHEVGYFV
GPIDANTPCNPRNPYGIAKNFLRQAMFDFASVTPELNLRWLRFYYITGDDRFNNSIFTKI
LKAEDEVQEYFPLNSGEMLYDFVDIKDLSLQIEERIISKESGIFNCCSGKPKSLRTAVEE
FIAEHNLKIKPKYNVFPARSYDSMAVWGAK
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaatataattataactggagccaatggatatattggaagatatgtagtaaaagaatta
cttaataaaggtcataaagtaatagcaattctttttgatggggaatctccccattctttc
ctaagcggagctgaattattttacggagatatatttgcattatctcaagagaaaaaagtt
gatttagttcaaaatgctgaatgtttattgcatttagcgtggcaagcaggctttaatcat
agagatccatctcatttaaacaatgtgatgaaacattatcaatttttaacttctatggca
gagttagggattaagaatatttctgttgctggaacaatgcatgaagtaggttatttcgtt
ggacctattgacgcaaatacgccttgtaacccaagaaatccctatggcatagcgaaaaac
ttcttacgtcaagcaatgtttgattttgcaagtgttacacctgaactaaatttacgatgg
ttacgtttttactatattacaggagatgatcgttttaataactcaatatttactaaaatt
ttgaaagcggaagatgaagtacaagagtatttcccattaaatagcggggaaatgctttat
gacttcgttgatattaaagacttatctttgcaaatcgaagaaagaattataagcaaagaa
tcaggtatctttaattgctgttctggaaaacctaaaagtttaagaacggcagtagaagaa
tttattgctgaacacaacttaaaaattaaacctaaatataatgttttccctgcaagatct
tatgattcaatggcagtgtggggagcaaaataa

DBGET integrated database retrieval system